Lineage for d4lhwa_ (4lhw A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1362078Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1362079Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1362829Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1363774Protein automated matches [190047] (16 species)
    not a true protein
  7. 1364028Species Mouse (Mus musculus) [TaxId:10090] [186896] (13 PDB entries)
  8. 1364032Domain d4lhwa_: 4lhw A: [229859]
    automated match to d4lhvd_
    complexed with gnp, mg, mpd

Details for d4lhwa_

PDB Entry: 4lhw (more details), 1.55 Å

PDB Description: Crystal structure of Rab8 in its active GppNHp-bound form
PDB Compounds: (A:) Ras-related protein Rab-8A

SCOPe Domain Sequences for d4lhwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lhwa_ c.37.1.8 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwdta
gqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdv
ndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk

SCOPe Domain Coordinates for d4lhwa_:

Click to download the PDB-style file with coordinates for d4lhwa_.
(The format of our PDB-style files is described here.)

Timeline for d4lhwa_: