SCOPe 2.03: Domain d4lhwd_: 4lhw D:

Lineage for d4lhwd_ (4lhw D:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein automated matches [190047] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186896] (13 PDB entries)

8. Domain d4lhwd_: 4lhw D: [229855]
   automated match to d4lhvd_
   complexed with gnp, mg, mpd

Details for d4lhwd_

PDB Entry: 4lhw, 1.55 Å

PDB Description: Crystal structure of Rab8 in its active GppNHp-bound form

PDB Compounds: (D:) Ras-related protein Rab-8A

SCOPe Domain Sequences for d4lhwd_:

Sequence; same for both SEQRES and ATOM records:

>d4lhwd_ c.37.1.8 (D:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
shdylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwd
tagqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkc
dvndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk

Timeline for d4lhwd_:

• d4lhwd_ is new in SCOPe 2.03-stable
  
• d4lhwd_ appears in SCOPe 2.04
  
• d4lhwd_ appears in the current release, SCOPe 2.08, called d4lhwd1