Lineage for d4lhvb_ (4lhv B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1594390Family c.37.1.8: G proteins [52592] (79 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 1595044Protein Rab8a [142293] (2 species)
  7. 1595045Species Human (Homo sapiens) [TaxId:9606] [254870] (4 PDB entries)
  8. 1595052Domain d4lhvb_: 4lhv B: [229852]
    automated match to d4lhvd_
    complexed with gdp, mg

Details for d4lhvb_

PDB Entry: 4lhv (more details), 1.95 Å

PDB Description: Crystal structure of Rab8 in its inactive GDP-bound form
PDB Compounds: (B:) Ras-related protein Rab-8A

SCOPe Domain Sequences for d4lhvb_:

Sequence, based on SEQRES records: (download)

>d4lhvb_ c.37.1.8 (B:) Rab8a {Human (Homo sapiens) [TaxId: 9606]}
hdylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwdt
agqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcd
vndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk

Sequence, based on observed residues (ATOM records): (download)

>d4lhvb_ c.37.1.8 (B:) Rab8a {Human (Homo sapiens) [TaxId: 9606]}
hdylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwdt
ayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdvndkrqvsker
geklaldygikfmetsakaninvenafftlardikakmdkk

SCOPe Domain Coordinates for d4lhvb_:

Click to download the PDB-style file with coordinates for d4lhvb_.
(The format of our PDB-style files is described here.)

Timeline for d4lhvb_: