SCOPe 2.05: Domain d4lhvb_: 4lhv B:

Lineage for d4lhvb_ (4lhv B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.8: G proteins [52592] (79 proteins)
   core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest

6. Protein Rab8a [142293] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [254870] (4 PDB entries)

8. Domain d4lhvb_: 4lhv B: [229852]
   automated match to d4lhvd_
   complexed with gdp, mg

Details for d4lhvb_

PDB Entry: 4lhv, 1.95 Å

PDB Description: Crystal structure of Rab8 in its inactive GDP-bound form

PDB Compounds: (B:) Ras-related protein Rab-8A

SCOPe Domain Sequences for d4lhvb_:

Sequence, based on SEQRES records:

>d4lhvb_ c.37.1.8 (B:) Rab8a {Human (Homo sapiens) [TaxId: 9606]}
hdylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwdt
agqerfrtittayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcd
vndkrqvskergeklaldygikfmetsakaninvenafftlardikakmdkk

Sequence, based on observed residues (ATOM records):

>d4lhvb_ c.37.1.8 (B:) Rab8a {Human (Homo sapiens) [TaxId: 9606]}
hdylfkllligdsgvgktcvlfrfsedafnstfistigidfkirtieldgkriklqiwdt
ayyrgamgimlvyditneksfdnirnwirnieehasadvekmilgnkcdvndkrqvsker
geklaldygikfmetsakaninvenafftlardikakmdkk

Timeline for d4lhvb_:

• d4lhvb_ first appeared in SCOPe 2.03
  
• d4lhvb_ appears in SCOPe 2.04
  
• d4lhvb_ is called d4lhvb1 in SCOPe 2.06
  
• d4lhvb_ appears in the current release, SCOPe 2.08, called d4lhvb1