Class a: All alpha proteins [46456] (286 folds) |
Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily) multihelical; consists of two all-alpha subdomains contains a 4-helical bundle with left-handed twist and up-and-down topology |
Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) |
Family a.91.1.0: automated matches [191379] (1 protein) not a true family |
Protein automated matches [190464] (2 species) not a true protein |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [229827] (1 PDB entry) |
Domain d4igub_: 4igu B: [229828] automated match to d2af0a_ complexed with cl, edo, na |
PDB Entry: 4igu (more details), 1.9 Å
SCOPe Domain Sequences for d4igub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4igub_ a.91.1.0 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} sqptleeirswgksfdklmkstagrkvfqnflrsefseenilfwlacedlkkenspelve ekarliyedyisilsprevsldsrvreivnrnmieptthtfdeaqiqiytlmhrdsyprf lnsqkfktlsrpaakln
Timeline for d4igub_: