SCOPe 2.08: Domain d4igub1: 4igu B:13-140

Lineage for d4igub1 (4igu B:13-140)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (3 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [229827] (1 PDB entry)

8. Domain d4igub1: 4igu B:13-140 [229828]
   Other proteins in same PDB: d4igua2, d4igua3, d4igub2, d4igub3
   automated match to d2af0a_
   complexed with cl, edo, na

Details for d4igub1

PDB Entry: 4igu, 1.9 Å

PDB Description: Crystal structure of the RGS domain of CG5036

PDB Compounds: (B:) cg5036

SCOPe Domain Sequences for d4igub1:

Sequence; same for both SEQRES and ATOM records:

>d4igub1 a.91.1.0 (B:13-140) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qptleeirswgksfdklmkstagrkvfqnflrsefseenilfwlacedlkkenspelvee
karliyedyisilsprevsldsrvreivnrnmieptthtfdeaqiqiytlmhrdsyprfl
nsqkfktl

Timeline for d4igub1:

• d4igub1 first appeared in SCOPe 2.03, called d4igub_
  
• d4igub1 appears in SCOPe 2.07