SCOPe 2.05: Domain d4hpxa_: 4hpx A:

Lineage for d4hpxa_ (4hpx A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families)

5. Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)

6. Protein Trp synthase alpha-subunit [51388] (8 species)

7. Species Salmonella enterica [TaxId:90371] [229811] (5 PDB entries)

8. Domain d4hpxa_: 4hpx A: [229812]
   Other proteins in same PDB: d4hpxb_
   automated match to d1k8ya_
   complexed with 0jo, bcn, bzi, cs, f9f, peg

Details for d4hpxa_

PDB Entry: 4hpx, 1.65 Å

PDB Description: crystal structure of tryptophan synthase at 1.65 a resolution in complex with alpha aminoacrylate e(a-a) and benzimidazole in the beta site and the f9 inhibitor in the alpha site

PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d4hpxa_:

Sequence; same for both SEQRES and ATOM records:

>d4hpxa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella enterica [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasra

Timeline for d4hpxa_:

• d4hpxa_ first appeared in SCOPe 2.03
  
• d4hpxa_ appears in SCOPe 2.04
  
• d4hpxa_ appears in SCOPe 2.06
  
• d4hpxa_ appears in the current release, SCOPe 2.08