| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) ![]() conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures |
| Family c.23.16.1: Class I glutamine amidotransferases (GAT) [52318] (12 proteins) contains a catalytic Cys-His-Glu triad |
| Protein FGAM synthase PurL, amidotransferase domain [110484] (3 species) |
| Species Salmonella typhimurium [TaxId:99287] [229696] (1 PDB entry) |
| Domain d4mgha7: 4mgh A:1034-1295 [229697] Other proteins in same PDB: d4mgha1, d4mgha2, d4mgha3, d4mgha4, d4mgha5, d4mgha6 automated match to d3ujna7 complexed with act, adp, mg, mn, so4, xe |
PDB Entry: 4mgh (more details), 2.65 Å
SCOPe Domain Sequences for d4mgha7:
Sequence; same for both SEQRES and ATOM records: (download)
>d4mgha7 c.23.16.1 (A:1034-1295) FGAM synthase PurL, amidotransferase domain {Salmonella typhimurium [TaxId: 99287]}
iatgarpkvavlreqgvnshvemaaafhragfdaidvhmsdllggriglgnfhalvacgg
fsygdvlgagegwaksilfnhrvrdefetffhrpqtlalgvcngcqmmsnlrelipgsel
wprfvrnhsdrfearfslvevtqspslllqgmvgsqmpiavshgegrvevrddahlaale
skglvalryvdnfgkvtetypanpngspngitavttengrvtimmphpervfrtvanswh
penwgedspwmrifrnarkqlg
Timeline for d4mgha7: