Lineage for d4mdkc_ (4mdk C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1407249Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 1407250Protein automated matches [190120] (5 species)
    not a true protein
  7. 1407255Species Human (Homo sapiens) [TaxId:9606] [186843] (8 PDB entries)
  8. 1407268Domain d4mdkc_: 4mdk C: [229685]
    Other proteins in same PDB: d4mdke_, d4mdkf_, d4mdkg_, d4mdkh_
    automated match to d2ob4a_
    complexed with u94

Details for d4mdkc_

PDB Entry: 4mdk (more details), 2.61 Å

PDB Description: Cdc34-ubiquitin-CC0651 complex
PDB Compounds: (C:) Ubiquitin-conjugating enzyme E2 R1

SCOPe Domain Sequences for d4mdkc_:

Sequence, based on SEQRES records: (download)

>d4mdkc_ d.20.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pssqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpi
dypysppafrfltkmwhpniyetgdvcisilhppvddpqsgelpserwnptqnvrtills
visllnepntfspanvdasvmyrkwkeskgkdreytdiirkqvlgtkvdaerdgvkvp

Sequence, based on observed residues (ATOM records): (download)

>d4mdkc_ d.20.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pssqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpi
dypysppafrfltkmwhpniyetgdvcisilhppserwnptqnvrtillsvisllnepnt
fspanvdasvmyrkwkeskgkdreytdiirkqvlgtkvdaerdgvkvp

SCOPe Domain Coordinates for d4mdkc_:

Click to download the PDB-style file with coordinates for d4mdkc_.
(The format of our PDB-style files is described here.)

Timeline for d4mdkc_: