![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.0: automated matches [191322] (1 protein) not a true family |
![]() | Protein automated matches [190120] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186843] (8 PDB entries) |
![]() | Domain d4mdkb_: 4mdk B: [229680] Other proteins in same PDB: d4mdke_, d4mdkf_, d4mdkg_, d4mdkh_ automated match to d2ob4a_ complexed with u94 |
PDB Entry: 4mdk (more details), 2.61 Å
SCOPe Domain Sequences for d4mdkb_:
Sequence, based on SEQRES records: (download)
>d4mdkb_ d.20.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pssqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpi dypysppafrfltkmwhpniyetgdvcisilhppvddpqsgelpserwnptqnvrtills visllnepntfspanvdasvmyrkwkeskgkdreytdiirkqvlgtkvdaerdgvkvp
>d4mdkb_ d.20.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pssqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpi dypysppafrfltkmwhpniyetgdvcisiwnptqnvrtillsvisllnepntfspanvd asvmyrkwkeskgkdreytdiirkqvlgtkvdaerdgvkvp
Timeline for d4mdkb_: