Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.0: automated matches [191322] (1 protein) not a true family |
Protein automated matches [190120] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186843] (28 PDB entries) |
Domain d4mdkc_: 4mdk C: [229685] Other proteins in same PDB: d4mdke1, d4mdke2, d4mdkf1, d4mdkf2, d4mdkg_, d4mdkh1, d4mdkh2 automated match to d2ob4a_ complexed with u94 |
PDB Entry: 4mdk (more details), 2.61 Å
SCOPe Domain Sequences for d4mdkc_:
Sequence, based on SEQRES records: (download)
>d4mdkc_ d.20.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pssqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpi dypysppafrfltkmwhpniyetgdvcisilhppvddpqsgelpserwnptqnvrtills visllnepntfspanvdasvmyrkwkeskgkdreytdiirkqvlgtkvdaerdgvkvp
>d4mdkc_ d.20.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pssqkalllelkglqeepvegfrvtlvdegdlynwevaifgppntyyeggyfkarlkfpi dypysppafrfltkmwhpniyetgdvcisilhppserwnptqnvrtillsvisllnepnt fspanvdasvmyrkwkeskgkdreytdiirkqvlgtkvdaerdgvkvp
Timeline for d4mdkc_: