SCOP 1.63: Domain d1e67c_: 1e67 C:

Lineage for d1e67c_ (1e67 C:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (5 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
   mono-domain proteins

6. Protein Azurin [49530] (6 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [49533] (32 PDB entries)

8. Domain d1e67c_: 1e67 C: [22949]

Details for d1e67c_

PDB Entry: 1e67, 2.14 Å

PDB Description: zn-azurin from pseudomonas aeruginosa

SCOP Domain Sequences for d1e67c_:

Sequence; same for both SEQRES and ATOM records:

>d1e67c_ b.6.1.1 (C:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

Timeline for d1e67c_:

• d1e67c_ first appeared (with stable ids) in SCOP 1.55
  
• d1e67c_ appears in SCOP 1.61
  
• d1e67c_ appears in SCOP 1.65
  
• d1e67c_ appears in the current release, SCOPe 2.08