Lineage for d3zngf_ (3zng F:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2177213Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2177238Protein Elongin B [54246] (2 species)
  7. 2177239Species Human (Homo sapiens) [TaxId:9606] [54247] (38 PDB entries)
  8. 2177349Domain d3zngf_: 3zng F: [229479]
    Other proteins in same PDB: d3zngb_, d3znge_
    automated match to d1lm8b_
    complexed with edo

Details for d3zngf_

PDB Entry: 3zng (more details), 2.85 Å

PDB Description: Ankyrin repeat and SOCS-box protein 9 (ASB9) in complex with ElonginB and ElonginC
PDB Compounds: (F:) Transcription elongation factor B polypeptide 2

SCOPe Domain Sequences for d3zngf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zngf_ d.15.1.1 (F:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
dvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgecg
ftsqtarpqapatvglafraddtfealciepfssppelpdvmkpq

SCOPe Domain Coordinates for d3zngf_:

Click to download the PDB-style file with coordinates for d3zngf_.
(The format of our PDB-style files is described here.)

Timeline for d3zngf_: