Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) |
Family d.15.1.1: Ubiquitin-related [54237] (39 proteins) Pfam PF00240 |
Protein Elongin B [54246] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54247] (38 PDB entries) |
Domain d3zngf_: 3zng F: [229479] Other proteins in same PDB: d3zngb_, d3znge_ automated match to d1lm8b_ complexed with edo |
PDB Entry: 3zng (more details), 2.85 Å
SCOPe Domain Sequences for d3zngf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zngf_ d.15.1.1 (F:) Elongin B {Human (Homo sapiens) [TaxId: 9606]} dvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgecg ftsqtarpqapatvglafraddtfealciepfssppelpdvmkpq
Timeline for d3zngf_: