PDB entry 3zng

View 3zng on RCSB PDB site
Description: Ankyrin repeat and SOCS-box protein 9 (ASB9) in complex with ElonginB and ElonginC
Class: transcription
Keywords: transcription, cullin-ring ligase
Deposited on 2013-02-14, released 2013-12-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-12-25, with a file datestamp of 2013-12-20.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.1969
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ankyrin repeat and socs box protein 9
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3zngb_
  • Chain 'C':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3zngc_
  • Chain 'D':
    Compound: ankyrin repeat and socs box protein 9
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: Transcription elongation factor B polypeptide 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3znge_
  • Chain 'F':
    Compound: Transcription elongation factor B polypeptide 2
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3zngf_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zngB (B:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zngB (B:)
    yvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvrytnsst
    eipefpiapeialellmaanfldc
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3zngC (C:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zngC (C:)
    dvflmirrhkttiftdakstvfelkrivegilkrppkddqlftsqtarpqapatvepfss
    ppelpdvmkp
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3zngE (E:)
    mmyvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcm
    yftykvrytnssteipefpiapeialellmaanfldc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zngE (E:)
    yvklissdghefivkrehaltsgtikamlnevnfreipshvlskvcmyftykvrytnsst
    eipefpiapeialellmaanfldc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3zngF (F:)
    mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
    gftsqtarpqapatvglafraddtfealciepfssppelpdvmkpqdsgssaneqavq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zngF (F:)
    dvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgecg
    ftsqtarpqapatvglafraddtfealciepfssppelpdvmkpq