Lineage for d4nbud_ (4nbu D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846072Species Bacillus sp. [TaxId:161544] [229451] (1 PDB entry)
  8. 2846076Domain d4nbud_: 4nbu D: [229452]
    Other proteins in same PDB: d4nbub2
    automated match to d4dbzb_
    complexed with caa, nai

Details for d4nbud_

PDB Entry: 4nbu (more details), 1.34 Å

PDB Description: Crystal structure of FabG from Bacillus sp
PDB Compounds: (D:) 3-oxoacyl-(acyl-carrier-protein) reductase

SCOPe Domain Sequences for d4nbud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nbud_ c.2.1.0 (D:) automated matches {Bacillus sp. [TaxId: 161544]}
srlqdkvaiitgaangigleaarvfmkegakvviadfneaagkeaveanpgvvfirvdvs
dresvhrlvenvaerfgkidilinnagitrdsmlskmtvdqfqqvinvnltgvfhctqav
lpymaeqgkgkiintssvtgtygnvgqtnyaaakagvigmtktwakelarkginvnavap
gftetamvaevpekviekmkaqvpmgrlgkpedianaylflashesdyvnghvlhvdggi
mm

SCOPe Domain Coordinates for d4nbud_:

Click to download the PDB-style file with coordinates for d4nbud_.
(The format of our PDB-style files is described here.)

Timeline for d4nbud_: