SCOPe 2.08: Domain d4nbub1: 4nbu B:8-250

Lineage for d4nbub1 (4nbu B:8-250)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Bacillus sp. [TaxId:161544] [229451] (1 PDB entry)

8. Domain d4nbub1: 4nbu B:8-250 [235763]
   Other proteins in same PDB: d4nbub2
   automated match to d4nbud_
   complexed with caa, nai

Details for d4nbub1

PDB Entry: 4nbu, 1.34 Å

PDB Description: Crystal structure of FabG from Bacillus sp

PDB Compounds: (B:) 3-oxoacyl-(acyl-carrier-protein) reductase

SCOPe Domain Sequences for d4nbub1:

Sequence; same for both SEQRES and ATOM records:

>d4nbub1 c.2.1.0 (B:8-250) automated matches {Bacillus sp. [TaxId: 161544]}
msrlqdkvaiitgaangigleaarvfmkegakvviadfneaagkeaveanpgvvfirvdv
sdresvhrlvenvaerfgkidilinnagitrdsmlskmtvdqfqqvinvnltgvfhctqa
vlpymaeqgkgkiintssvtgtygnvgqtnyaaakagvigmtktwakelarkginvnava
pgftetamvaevpekviekmkaqvpmgrlgkpedianaylflashesdyvnghvlhvdgg
imm

Timeline for d4nbub1:

• d4nbub1 first appeared in SCOPe 2.03, called d4nbub_
  
• d4nbub1 appears in SCOPe 2.07