SCOPe 2.04: Domain d4i97a2: 4i97 A:86-208

Lineage for d4i97a2 (4i97 A:86-208)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (41 species)
   not a true protein

7. Species Scaptomyza nigrita [TaxId:928823] [229398] (1 PDB entry)

8. Domain d4i97a2: 4i97 A:86-208 [229399]
   Other proteins in same PDB: d4i97a1, d4i97b1
   automated match to d3eina2
   complexed with gsh

Details for d4i97a2

PDB Entry: 4i97, 2.15 Å

PDB Description: The crystal structure of glutathione S-transferase SnigGSTD1A from Scaptomyza nigrita in complex with glutathione

PDB Compounds: (A:) delta class 1 glutathione s-transferase

SCOPe Domain Sequences for d4i97a2:

Sequence; same for both SEQRES and ATOM records:

>d4i97a2 a.45.1.0 (A:86-208) automated matches {Scaptomyza nigrita [TaxId: 928823]}
kcpkkravinqrlyfdmgtlyqsfanyyypqvfakapadpelykkmeaaveflntflegq
tyaagdsltiadiallatmssfevagydfskyenvnkwyanakkvtpgwdenwagcqefk
kyf

Timeline for d4i97a2:

• d4i97a2 first appeared in SCOPe 2.03
  
• d4i97a2 appears in SCOPe 2.05
  
• d4i97a2 appears in the current release, SCOPe 2.08