Class a: All alpha proteins [46456] (285 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (41 species) not a true protein |
Species Scaptomyza nigrita [TaxId:928823] [229398] (1 PDB entry) |
Domain d4i97a2: 4i97 A:86-208 [229399] Other proteins in same PDB: d4i97a1, d4i97b1 automated match to d3eina2 complexed with gsh |
PDB Entry: 4i97 (more details), 2.15 Å
SCOPe Domain Sequences for d4i97a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i97a2 a.45.1.0 (A:86-208) automated matches {Scaptomyza nigrita [TaxId: 928823]} kcpkkravinqrlyfdmgtlyqsfanyyypqvfakapadpelykkmeaaveflntflegq tyaagdsltiadiallatmssfevagydfskyenvnkwyanakkvtpgwdenwagcqefk kyf
Timeline for d4i97a2: