Lineage for d4i97a2 (4i97 A:86-208)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2714196Species Scaptomyza nigrita [TaxId:928823] [229398] (1 PDB entry)
  8. 2714197Domain d4i97a2: 4i97 A:86-208 [229399]
    Other proteins in same PDB: d4i97a1, d4i97b1
    automated match to d3eina2
    complexed with gsh

Details for d4i97a2

PDB Entry: 4i97 (more details), 2.15 Å

PDB Description: The crystal structure of glutathione S-transferase SnigGSTD1A from Scaptomyza nigrita in complex with glutathione
PDB Compounds: (A:) delta class 1 glutathione s-transferase

SCOPe Domain Sequences for d4i97a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i97a2 a.45.1.0 (A:86-208) automated matches {Scaptomyza nigrita [TaxId: 928823]}
kcpkkravinqrlyfdmgtlyqsfanyyypqvfakapadpelykkmeaaveflntflegq
tyaagdsltiadiallatmssfevagydfskyenvnkwyanakkvtpgwdenwagcqefk
kyf

SCOPe Domain Coordinates for d4i97a2:

Click to download the PDB-style file with coordinates for d4i97a2.
(The format of our PDB-style files is described here.)

Timeline for d4i97a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i97a1