Lineage for d1vlxd_ (1vlx D:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 224388Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 224389Superfamily b.6.1: Cupredoxins [49503] (5 families) (S)
    contains copper-binding site
  5. 224390Family b.6.1.1: Plastocyanin/azurin-like [49504] (8 proteins)
    mono-domain proteins
  6. 224416Protein Azurin [49530] (6 species)
  7. 224445Species Pseudomonas aeruginosa [TaxId:287] [49533] (32 PDB entries)
  8. 224464Domain d1vlxd_: 1vlx D: [22930]
    complexed with co

Details for d1vlxd_

PDB Entry: 1vlx (more details), 1.9 Å

PDB Description: structure of electron transfer (cobalt-protein)

SCOP Domain Sequences for d1vlxd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlxd_ b.6.1.1 (D:) Azurin {Pseudomonas aeruginosa}
aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
mkgtltlk

SCOP Domain Coordinates for d1vlxd_:

Click to download the PDB-style file with coordinates for d1vlxd_.
(The format of our PDB-style files is described here.)

Timeline for d1vlxd_: