SCOPe 2.06: Domain d3zc3a2: 3zc3 A:142-303

Lineage for d3zc3a2 (3zc3 A:142-303)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.25: Ferredoxin reductase-like, C-terminal NADP-linked domain [52342] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.25.1: Ferredoxin reductase-like, C-terminal NADP-linked domain [52343] (6 families)
   binds NADP differently than classical Rossmann-fold
   N-terminal FAD-linked domain contains (6,10) barrel

5. Family c.25.1.1: Reductases [52344] (5 proteins)

6. Protein automated matches [226995] (7 species)
   not a true protein

7. Species Nostoc sp. [TaxId:1168] [229177] (3 PDB entries)

8. Domain d3zc3a2: 3zc3 A:142-303 [229180]
   Other proteins in same PDB: d3zc3a1, d3zc3b1
   automated match to d1ewya2
   complexed with fad, gol, nap; mutant

Details for d3zc3a2

PDB Entry: 3zc3, 2.3 Å

PDB Description: ferredoxin-nadp reductase (mutation s80a) complexed with nadp by cocrystallization

PDB Compounds: (A:) ferredoxin-nadp reductase

SCOPe Domain Sequences for d3zc3a2:

Sequence; same for both SEQRES and ATOM records:

>d3zc3a2 c.25.1.1 (A:142-303) automated matches {Nostoc sp. [TaxId: 1168]}
lpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfswlvfgvpttpnily
keeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadelwqliknekthtyic
glrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety

Timeline for d3zc3a2:

• d3zc3a2 first appeared in SCOPe 2.03
  
• d3zc3a2 appears in SCOPe 2.05
  
• d3zc3a2 appears in SCOPe 2.07
  
• d3zc3a2 appears in the current release, SCOPe 2.08