PDB entry 3zc3

View 3zc3 on RCSB PDB site
Description: ferredoxin-nadp reductase (mutation s80a) complexed with nadp by cocrystallization
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2012-11-15, released 2013-11-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-01-08, with a file datestamp of 2014-01-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.20114
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin-nadp reductase
    Species: NOSTOC SP. PCC7119 [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21890 (Start-302)
      • engineered mutation (79)
      • conflict (253)
    Domains in SCOPe 2.06: d3zc3a1, d3zc3a2
  • Chain 'B':
    Compound: ferredoxin-nadp reductase
    Species: NOSTOC SP. PCC7119 [TaxId:1168]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21890 (Start-302)
      • engineered mutation (79)
      • conflict (253)
    Domains in SCOPe 2.06: d3zc3b1, d3zc3b2
  • Heterogens: FAD, NAP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3zc3A (A:)
    tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
    giippgvdkngkpeklrlyaiastrhgddvddktislcvrqleykhpesgetvygvcsty
    lthiepgsevkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpe
    yqfkgfswlvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrv
    aehadelwqliknekthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhv
    ety
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zc3A (A:)
    dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
    kngkpeklrlyaiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
    evkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfsw
    lvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadelw
    qliknekthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3zc3B (B:)
    tqakakhadvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsi
    giippgvdkngkpeklrlyaiastrhgddvddktislcvrqleykhpesgetvygvcsty
    lthiepgsevkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpe
    yqfkgfswlvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrv
    aehadelwqliknekthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhv
    ety
    

    Sequence, based on observed residues (ATOM records): (download)
    >3zc3B (B:)
    dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
    kngkpeklrlyaiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
    evkitgpvgkemllpddpeanvimlatgtgiapmrtylwrmfkdaeraanpeyqfkgfsw
    lvfgvpttpnilykeeleeiqqkypdnfrltyaisreqknpqggrmyiqdrvaehadelw
    qliknekthtyicglrgmeegidaalsaaaakegvtwsdyqkdlkkagrwhvety