| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
| Protein Alkyl hydroperoxide reductase AhpC [69516] (5 species) |
| Species Salmonella enterica [TaxId:90371] [229124] (7 PDB entries) |
| Domain d4ma9b_: 4ma9 B: [229129] automated match to d1yepa_ complexed with cl, gol, k |
PDB Entry: 4ma9 (more details), 1.82 Å
SCOPe Domain Sequences for d4ma9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ma9b_ c.47.1.10 (B:) Alkyl hydroperoxide reductase AhpC {Salmonella enterica [TaxId: 90371]}
slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
dlvgki
Timeline for d4ma9b_:
View in 3DDomains from other chains: (mouse over for more information) d4ma9a_, d4ma9c_, d4ma9d_, d4ma9e_ |