Lineage for d4ma9b_ (4ma9 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877441Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)
  6. 2877472Protein Alkyl hydroperoxide reductase AhpC [69516] (5 species)
  7. 2877479Species Salmonella enterica [TaxId:90371] [229124] (7 PDB entries)
  8. 2877481Domain d4ma9b_: 4ma9 B: [229129]
    automated match to d1yepa_
    complexed with cl, gol, k

Details for d4ma9b_

PDB Entry: 4ma9 (more details), 1.82 Å

PDB Description: Wild type Salmonella Alkyl Hydroperoxide Reductase C in its substrate-ready conformation
PDB Compounds: (B:) Alkyl hydroperoxide reductase subunit C

SCOPe Domain Sequences for d4ma9b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ma9b_ c.47.1.10 (B:) Alkyl hydroperoxide reductase AhpC {Salmonella enterica [TaxId: 90371]}
slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
dlvgki

SCOPe Domain Coordinates for d4ma9b_:

Click to download the PDB-style file with coordinates for d4ma9b_.
(The format of our PDB-style files is described here.)

Timeline for d4ma9b_: