SCOPe 2.08: Domain d4ma9b_: 4ma9 B:

Lineage for d4ma9b_ (4ma9 B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Alkyl hydroperoxide reductase AhpC [69516] (5 species)

7. Species Salmonella enterica [TaxId:90371] [229124] (7 PDB entries)

8. Domain d4ma9b_: 4ma9 B: [229129]
   automated match to d1yepa_
   complexed with cl, gol, k

Details for d4ma9b_

PDB Entry: 4ma9, 1.82 Å

PDB Description: Wild type Salmonella Alkyl Hydroperoxide Reductase C in its substrate-ready conformation

PDB Compounds: (B:) Alkyl hydroperoxide reductase subunit C

SCOPe Domain Sequences for d4ma9b_:

Sequence; same for both SEQRES and ATOM records:

>d4ma9b_ c.47.1.10 (B:) Alkyl hydroperoxide reductase AhpC {Salmonella enterica [TaxId: 90371]}
slintkikpfknqafkngefievtekdtegrwsvfffypadftfvcptelgdvadhyeel
qklgvdvysvstdthfthkawhsssetiakikyamigdptgaltrnfdnmredegladra
tfvvdpqgiiqaievtaegigrdasdllrkikaaqyvaahpgevcpakwkegeatlapsl
dlvgki

Timeline for d4ma9b_:

• d4ma9b_ first appeared in SCOPe 2.03
  
• d4ma9b_ appears in SCOPe 2.07