SCOPe 2.08: Domain d3w1aa_: 3w1a A:

Lineage for d3w1aa_ (3w1a A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families)

5. Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 proteins)

6. Protein Dihydroorotate dehydrogenase [51397] (8 species)

7. Species Trypanosoma cruzi [TaxId:353153] [254868] (49 PDB entries)

8. Domain d3w1aa_: 3w1a A: [229028]
   automated match to d2e68b_
   complexed with fmn, fot, gol, nco
   has additional subdomain(s) that are not in the common domain
   has additional insertions and/or extensions that are not grouped together

Details for d3w1aa_

PDB Entry: 3w1a, 1.42 Å

PDB Description: Structure of Trypanosoma cruzi dihydroorotate dehydrogenase in complex with 5-halogenated orotate derivatives

PDB Compounds: (A:) Dihydroorotate dehydrogenase (fumarate)

SCOPe Domain Sequences for d3w1aa_:

Sequence; same for both SEQRES and ATOM records:

>d3w1aa_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Trypanosoma cruzi [TaxId: 353153]}
mclklnlldhvfanpfmnaagvlcsteedlrcmtasssgalvsksctsaprdgnpeprym
afplgsinsmglpnlgfdfylkyasdlhdyskkplflsisglsveenvamvrrlapvaqe
kgvllelnlscpnvpgkpqvaydfeamrtylqqvslayglpfgvkmppyfdiahfdtaaa
vlnefplvkfvtcvnsvgnglvidaesesvvikpkqgfgglggkyilptalanvnafyrr
cpdklvfgcggvysgedaflhilagasmvqvgtalqeegpgiftrledelleimarkgyr
tleefrgrvktie

Timeline for d3w1aa_:

• d3w1aa_ first appeared in SCOPe 2.03
  
• d3w1aa_ appears in SCOPe 2.07