SCOPe 2.06: Domain d4mf0b_: 4mf0 B:

Lineage for d4mf0b_ (4mf0 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Tyrosine-protein kinase Itk/Tsk [111194] (1 species)
   PTK group; Tec/Atk subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [111195] (33 PDB entries)
   Uniprot Q08881 357-619

8. Domain d4mf0b_: 4mf0 B: [228994]
   automated match to d4kioa_
   complexed with 29z

Details for d4mf0b_

PDB Entry: 4mf0, 2.67 Å

PDB Description: itk kinase domain in complex with benzothiazole inhibitor compound 12a (1s,2s)-2-{4-[(dimethylamino)methyl]phenyl}-n-[6-(pyridin-3-yl)-1,3-benzothiazol-2-yl]cyclopropanecarboxamide (12a)

PDB Compounds: (B:) Tyrosine-protein kinase ITK/TSK

SCOPe Domain Sequences for d4mf0b_:

Sequence, based on SEQRES records:

>d4mf0b_ d.144.1.7 (B:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsgqfglvhlgywlnkdkvaiktiregamseedfieeaevmmklshp
klvqlygvcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleea
cvihrdlaarnclvgenqvikvsdfgmtrfvlddqetsstgtkfpvkwaspevfsfsrys
sksdvwsfgvlmwevfsegkipyenrsnsevvedistgfrlykprlasthvyqimnhcwk
erpedrpafsrllrqlaeiaesg

Sequence, based on observed residues (ATOM records):

>d4mf0b_ d.144.1.7 (B:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]}
vidpseltfvqeigsglvhlgywlnkdkvaiktimseedfieeaevmmklshpklvqlyg
vcleqapiclvfefmehgclsdylrtqrglfaaetllgmcldvcegmayleeacvihrdl
aarnclvgenqvikvsdfpvkwaspevfsfsryssksdvwsfgvlmwevfsegkipyenr
snsevvedistgfrlykprlasthvyqimnhcwkerpedrpafsrllrqlaeiaesg

Timeline for d4mf0b_:

• d4mf0b_ first appeared in SCOPe 2.03
  
• d4mf0b_ appears in SCOPe 2.05
  
• d4mf0b_ appears in SCOPe 2.07
  
• d4mf0b_ appears in the current release, SCOPe 2.08