SCOPe 2.06: Domain d4navd_: 4nav D:

Lineage for d4navd_ (4nav D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (51 species)
   not a true protein

7. Species Xanthomonas campestris [TaxId:190485] [228883] (1 PDB entry)

8. Domain d4navd_: 4nav D: [228884]
   automated match to d2r8xh_

Details for d4navd_

PDB Entry: 4nav, 2.69 Å

PDB Description: Crystal structure of hypothetical protein XCC2798 from Xanthomonas campestris, Target EFI-508608

PDB Compounds: (D:) hypothetical protein xcc279

SCOPe Domain Sequences for d4navd_:

Sequence; same for both SEQRES and ATOM records:

>d4navd_ c.108.1.0 (D:) automated matches {Xanthomonas campestris [TaxId: 190485]}
mpysplqdlpadlidraarvrlacfdvdgtltdgrlyydhagneskafnvldgqglkqle
hagihvalitaraslsaekrgqdlglhvqigvknkrlavlalcqehglsldqvlfmgddl
pdlpallavglpvapanahpwiaervqwhtrarggegaarevcdvvlaaqgqvdsiiarf
sa

Timeline for d4navd_:

• d4navd_ first appeared in SCOPe 2.03
  
• d4navd_ appears in SCOPe 2.05
  
• d4navd_ appears in SCOPe 2.07
  
• d4navd_ appears in the current release, SCOPe 2.08