PDB entry 4nav

View 4nav on RCSB PDB site
Description: Crystal structure of hypothetical protein XCC2798 from Xanthomonas campestris, Target EFI-508608
Class: hydrolase
Keywords: Structural Genomics, Enzyme Function Initiative, hydrolase
Deposited on 2013-10-22, released 2013-11-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 2.69 Å
R-factor: 0.245
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein xcc279
    Species: Xanthomonas campestris pv. campestris [TaxId:190485]
    Gene: XCC2798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4nava_
  • Chain 'B':
    Compound: hypothetical protein xcc279
    Species: Xanthomonas campestris pv. campestris [TaxId:190485]
    Gene: XCC2798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4navb_
  • Chain 'C':
    Compound: hypothetical protein xcc279
    Species: Xanthomonas campestris pv. campestris [TaxId:190485]
    Gene: XCC2798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4navc_
  • Chain 'D':
    Compound: hypothetical protein xcc279
    Species: Xanthomonas campestris pv. campestris [TaxId:190485]
    Gene: XCC2798
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4navd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4navA (A:)
    mpysplqdlpadlidraarvrlacfdvdgtltdgrlyydhagneskafnvldgqglkqle
    hagihvalitaraslsaekrgqdlglhvqigvknkrlavlalcqehglsldqvlfmgddl
    pdlpallavglpvapanahpwiaervqwhtrarggegaarevcdvvlaaqgqvdsiiarf
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4navA (A:)
    pysplqdlpadlidraarvrlacfdvdgtltdgrlyydhagneskafnvldgqglkqleh
    agihvalitaraslsaekrgqdlglhvqigvknkrlavlalcqehglsldqvlfmgddlp
    dlpallavglpvapanahpwiaervqwhtrarggegaarevcdvvlaaqgqvdsiiarfs
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4navB (B:)
    mpysplqdlpadlidraarvrlacfdvdgtltdgrlyydhagneskafnvldgqglkqle
    hagihvalitaraslsaekrgqdlglhvqigvknkrlavlalcqehglsldqvlfmgddl
    pdlpallavglpvapanahpwiaervqwhtrarggegaarevcdvvlaaqgqvdsiiarf
    sa
    

    Sequence, based on observed residues (ATOM records): (download)
    >4navB (B:)
    mpysplqdlpadlidraarvrlacfdvdgtltdgrlyydhagneskafnvldgqglkqle
    hagihvalitaraslsaekrgqdlglhvqigvknkrlavlalcqehglsldqvlfmgddl
    pdlpallavglpvapanahpwiaervqwhtrarggegaarevcdvvlaaqgqvdsiiarf
    s
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4navC (C:)
    mpysplqdlpadlidraarvrlacfdvdgtltdgrlyydhagneskafnvldgqglkqle
    hagihvalitaraslsaekrgqdlglhvqigvknkrlavlalcqehglsldqvlfmgddl
    pdlpallavglpvapanahpwiaervqwhtrarggegaarevcdvvlaaqgqvdsiiarf
    sa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4navD (D:)
    mpysplqdlpadlidraarvrlacfdvdgtltdgrlyydhagneskafnvldgqglkqle
    hagihvalitaraslsaekrgqdlglhvqigvknkrlavlalcqehglsldqvlfmgddl
    pdlpallavglpvapanahpwiaervqwhtrarggegaarevcdvvlaaqgqvdsiiarf
    sa