Lineage for d1paza_ (1paz A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1114375Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 1114376Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 1114377Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 1114791Protein Pseudoazurin [49522] (4 species)
  7. 1114797Species Alcaligenes faecalis, strain s-6 [TaxId:511] [49523] (13 PDB entries)
    Uniprot P04377
  8. 1114798Domain d1paza_: 1paz A: [22878]
    complexed with cu

Details for d1paza_

PDB Entry: 1paz (more details), 1.55 Å

PDB Description: refinement of the structure of pseudoazurin from alcaligenes faecalis s-6 at 1.55 angstroms resolution
PDB Compounds: (A:) pseudoazurin precursor

SCOPe Domain Sequences for d1paza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]}
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia

SCOPe Domain Coordinates for d1paza_:

Click to download the PDB-style file with coordinates for d1paza_.
(The format of our PDB-style files is described here.)

Timeline for d1paza_: