SCOPe 2.02: Structural Classification of Proteins

PDB entry 1paz

View 1paz on RCSB PDB site
Description: refinement of the structure of pseudoazurin from alcaligenes faecalis s-6 at 1.55 angstroms resolution
Class: electron transfer(cuproprotein)
Keywords: electron transfer(cuproprotein)
Deposited on 1988-06-28, released 1988-10-09
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.18
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: pseudoazurin precursor
Species: Alcaligenes faecalis [TaxId:511]
Database cross-references and differences (RAF-indexed):
- Uniprot P04377 (0-End)
Domains in SCOPe 2.02: d1paza_
Heterogens: CU, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1pazA (A:)
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia
sak

Sequence, based on observed residues (ATOM records): (download)

>1pazA (A:)
enievhmlnkgaegamvfepayikanpgdtvtfipvdkghnvesikdmipegaekfkski
nenyvltvtqpgaylvkctphyamgmialiavgdspanldqivsakkpkivqerlekvia