SCOP 1.75: Domain d1b3ia_: 1b3i A:

Lineage for d1b3ia_ (1b3i A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (7 families)
   contains copper-binding site

5. Family b.6.1.1: Plastocyanin/azurin-like [49504] (9 proteins)
   mono-domain proteins

6. Protein Plastocyanin [49507] (14 species)

7. Species Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId:1223] [49521] (3 PDB entries)

8. Domain d1b3ia_: 1b3i A: [22877]
   complexed with cu; mutant

Details for d1b3ia_

PDB Entry: 1b3i

PDB Description: nmr solution structure of plastocyanin from the photosynthetic prokaryote, prochlorothrix hollandica (minimized average structure)

PDB Compounds: (A:) protein (plastocyanin)

SCOP Domain Sequences for d1b3ia_:

Sequence; same for both SEQRES and ATOM records:

>d1b3ia_ b.6.1.1 (A:) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]}
asvqikmgtdkyaplyepkalsisagdtvefvmnkvgphnvifdkvpagesapalsntkl
aiapgsfysvtlgtpgtysfyctphrgagmvgtitve

Timeline for d1b3ia_:

• d1b3ia_ first appeared (with stable ids) in SCOP 1.55
  
• d1b3ia_ appears in SCOP 1.73
  
• d1b3ia_ appears in SCOPe 2.01
  
• d1b3ia_ appears in the current release, SCOPe 2.08