Lineage for d1b3ia_ (1b3i A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2770400Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2770828Protein Plastocyanin [49507] (17 species)
  7. 2770875Species Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId:1223] [49521] (3 PDB entries)
  8. 2770877Domain d1b3ia_: 1b3i A: [22877]
    complexed with cu1

Details for d1b3ia_

PDB Entry: 1b3i (more details)

PDB Description: nmr solution structure of plastocyanin from the photosynthetic prokaryote, prochlorothrix hollandica (minimized average structure)
PDB Compounds: (A:) protein (plastocyanin)

SCOPe Domain Sequences for d1b3ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3ia_ b.6.1.1 (A:) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]}
asvqikmgtdkyaplyepkalsisagdtvefvmnkvgphnvifdkvpagesapalsntkl
aiapgsfysvtlgtpgtysfyctphrgagmvgtitve

SCOPe Domain Coordinates for d1b3ia_:

Click to download the PDB-style file with coordinates for d1b3ia_.
(The format of our PDB-style files is described here.)

Timeline for d1b3ia_: