Lineage for d3wdna_ (3wdn A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426782Superfamily b.84.1: Single hybrid motif [51230] (2 families) (S)
    7 to 8 strands in 2 beta-sheets
  5. 2426863Family b.84.1.0: automated matches [191593] (1 protein)
    not a true family
  6. 2426864Protein automated matches [191080] (7 species)
    not a true protein
  7. 2426867Species Cow (Bos taurus) [TaxId:9913] [189360] (2 PDB entries)
  8. 2426868Domain d3wdna_: 3wdn A: [228741]
    automated match to d3klra_
    complexed with gol

Details for d3wdna_

PDB Entry: 3wdn (more details), 0.86 Å

PDB Description: High-resolution X-ray crystal structure of bovine H-protein using a high-pressure cryocooling method
PDB Compounds: (A:) Glycine cleavage system H protein, mitochondrial

SCOPe Domain Sequences for d3wdna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wdna_ b.84.1.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svrkftekhewvttengvgtvgisnfaqealgdvvycslpevgtklnkqeefgalesvka
aselysplsgevteinkalaenpglvnkscyedgwlikmtfsnpseldelmseeayekyi
ksiee

SCOPe Domain Coordinates for d3wdna_:

Click to download the PDB-style file with coordinates for d3wdna_.
(The format of our PDB-style files is described here.)

Timeline for d3wdna_: