Lineage for d4n5ua_ (4n5u A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1521239Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1521748Family b.1.2.0: automated matches [191562] (1 protein)
    not a true family
  6. 1521749Protein automated matches [190976] (2 species)
    not a true protein
  7. 1521766Species Human (Homo sapiens) [TaxId:9606] [188649] (27 PDB entries)
  8. 1521767Domain d4n5ua_: 4n5u A: [228721]
    automated match to d1va9a1
    complexed with so4

Details for d4n5ua_

PDB Entry: 4n5u (more details), 1.46 Å

PDB Description: crystal structure of the 4th fn3 domain of human protein tyrosine phosphatase, receptor type f [psi-nysgrc-006240]
PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase F

SCOPe Domain Sequences for d4n5ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4n5ua_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqstpsappqkvmcvsmgsttvrvswvpppadsrngvitqysvayeavdgedrgrhvvdg
isrehsswdlvglekwteyrvwvrahtdvgpgpesspvlvrtdeaenl

SCOPe Domain Coordinates for d4n5ua_:

Click to download the PDB-style file with coordinates for d4n5ua_.
(The format of our PDB-style files is described here.)

Timeline for d4n5ua_: