SCOPe 2.08: Domain d4n5ua1: 4n5u A:602-705

Lineage for d4n5ua1 (4n5u A:602-705)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries)

8. Domain d4n5ua1: 4n5u A:602-705 [228721]
   Other proteins in same PDB: d4n5ua2
   automated match to d1va9a1
   complexed with so4

Details for d4n5ua1

PDB Entry: 4n5u, 1.46 Å

PDB Description: crystal structure of the 4th fn3 domain of human protein tyrosine phosphatase, receptor type f [psi-nysgrc-006240]

PDB Compounds: (A:) Receptor-type tyrosine-protein phosphatase F

SCOPe Domain Sequences for d4n5ua1:

Sequence; same for both SEQRES and ATOM records:

>d4n5ua1 b.1.2.0 (A:602-705) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqstpsappqkvmcvsmgsttvrvswvpppadsrngvitqysvayeavdgedrgrhvvdg
isrehsswdlvglekwteyrvwvrahtdvgpgpesspvlvrtde

Timeline for d4n5ua1:

• d4n5ua1 first appeared in SCOPe 2.03, called d4n5ua_
  
• d4n5ua1 appears in SCOPe 2.07