Lineage for d4m75c_ (4m75 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2786770Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2786771Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2787428Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 2787429Protein automated matches [190914] (14 species)
    not a true protein
  7. 2787484Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [228531] (5 PDB entries)
  8. 2787499Domain d4m75c_: 4m75 C: [228532]
    Other proteins in same PDB: d4m75g2, d4m75n2
    automated match to d3bw1a_
    protein/RNA complex; complexed with cl

Details for d4m75c_

PDB Entry: 4m75 (more details), 2.95 Å

PDB Description: Crystal structure of Lsm1-7 complex
PDB Compounds: (C:) U6 snRNA-associated Sm-like protein LSm3

SCOPe Domain Sequences for d4m75c_:

Sequence, based on SEQRES records: (download)

>d4m75c_ b.38.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqlnneelseserrs
emvfirgdtvtlistp

Sequence, based on observed residues (ATOM records): (download)

>d4m75c_ b.38.1.0 (C:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
pldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqseserrsemvfir
gdtvtlistp

SCOPe Domain Coordinates for d4m75c_:

Click to download the PDB-style file with coordinates for d4m75c_.
(The format of our PDB-style files is described here.)

Timeline for d4m75c_: