Class b: All beta proteins [48724] (180 folds) |
Fold b.38: Sm-like fold [50181] (5 superfamilies) core: barrel, open; n*=4, S*=8; meander; SH3-like topology |
Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) |
Family b.38.1.0: automated matches [191538] (1 protein) not a true family |
Protein automated matches [190914] (14 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [228531] (5 PDB entries) |
Domain d4m75j_: 4m75 J: [235538] Other proteins in same PDB: d4m75g2, d4m75n2 automated match to d4m78c_ protein/RNA complex; complexed with cl |
PDB Entry: 4m75 (more details), 2.95 Å
SCOPe Domain Sequences for d4m75j_:
Sequence, based on SEQRES records: (download)
>d4m75j_ b.38.1.0 (J:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tpldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqlnneelseserr semvfirgdtvtlistp
>d4m75j_ b.38.1.0 (J:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} tpldllklnldervyiklrgartlvgtlqafdshsnivlsdavetiyqleelseserrse mvfirgdtvtlistp
Timeline for d4m75j_: