Lineage for d4ki0b2 (4ki0 B:236-371)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2790988Superfamily b.40.6: MOP-like [50331] (4 families) (S)
  5. 2791072Family b.40.6.3: ABC-transporter additional domain [50338] (4 proteins)
    probably stems out from the biMOP domain
  6. 2791092Protein Maltose transport protein MalK, C-terminal domain [63406] (2 species)
  7. 2791093Species Escherichia coli [TaxId:562] [101772] (15 PDB entries)
  8. 2791105Domain d4ki0b2: 4ki0 B:236-371 [228490]
    Other proteins in same PDB: d4ki0a1, d4ki0a3, d4ki0b1, d4ki0b3, d4ki0e_, d4ki0f1, d4ki0f2, d4ki0g_
    automated match to d2awna1
    complexed with anp, mg, pgv, umq

Details for d4ki0b2

PDB Entry: 4ki0 (more details), 2.38 Å

PDB Description: crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose
PDB Compounds: (B:) ABC transporter related protein

SCOPe Domain Sequences for d4ki0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ki0b2 b.40.6.3 (B:236-371) Maltose transport protein MalK, C-terminal domain {Escherichia coli [TaxId: 562]}
spkmnflpvkvtataidqvqvelpmpnrqqvwlpvesrdvqvganmslgirpehllpsdi
advilegevqvveqlgnetqihiqipsirqnlvyrqndvvlveegatfaiglpperchlf
redgtacrrlhkepgv

SCOPe Domain Coordinates for d4ki0b2:

Click to download the PDB-style file with coordinates for d4ki0b2.
(The format of our PDB-style files is described here.)

Timeline for d4ki0b2: