SCOPe 2.08: Domain d4ki0f2: 4ki0 F:261-505

Lineage for d4ki0f2 (4ki0 F:261-505)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.58: MetI-like [161097] (1 superfamily)
   core: 5 transmembrane helices; flattened bundle

4. Superfamily f.58.1: MetI-like [161098] (1 family)

5. Family f.58.1.1: MetI-like [161099] (6 proteins)
   Pfam PF00528; Binding-protein-dependent transport system inner membrane component

6. Protein Maltose transport system permease protein MalF [161106] (1 species)

7. Species Escherichia coli [TaxId:562] [161107] (10 PDB entries)
   Uniprot P02916 261-504

8. Domain d4ki0f2: 4ki0 F:261-505 [228482]
   Other proteins in same PDB: d4ki0a1, d4ki0a2, d4ki0a3, d4ki0b1, d4ki0b2, d4ki0b3, d4ki0e_, d4ki0f1, d4ki0g_
   automated match to d2r6gf2
   complexed with anp, mg, pgv, umq

Details for d4ki0f2

PDB Entry: 4ki0, 2.38 Å

PDB Description: crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose

PDB Compounds: (F:) Maltose transport system permease protein malF

SCOPe Domain Sequences for d4ki0f2:

Sequence; same for both SEQRES and ATOM records:

>d4ki0f2 f.58.1.1 (F:261-505) Maltose transport system permease protein MalF {Escherichia coli [TaxId: 562]}
wknftrvftdegiqkpflaifvwtvvfslitvfltvavgmvlaclvqwealrgkavyrvl
lilpyavpsfisilifkglfnqsfgeinmmlsalfgvkpawfsdpttartmliivntwlg
ypymmilcmgllkaipddlyeasamdgagpfqnffkitlpllikpltplmiasfafnfnn
fvliqlltnggpdrlgtttpagytdllvnytyriafeggggqdfglaaaiatlifllvga
laivn

Timeline for d4ki0f2:

• d4ki0f2 first appeared in SCOPe 2.03
  
• d4ki0f2 appears in SCOPe 2.07