Lineage for d4ki0a1 (4ki0 A:2-235)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2478252Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins)
    there are two additional subdomains inserted into the central core that has a RecA-like topology
  6. 2478395Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species)
  7. 2478396Species Escherichia coli [TaxId:562] [102380] (15 PDB entries)
  8. 2478409Domain d4ki0a1: 4ki0 A:2-235 [228487]
    Other proteins in same PDB: d4ki0a2, d4ki0a3, d4ki0b2, d4ki0b3, d4ki0e_, d4ki0f1, d4ki0f2, d4ki0g_
    automated match to d2awna2
    complexed with anp, mg, pgv, umq

Details for d4ki0a1

PDB Entry: 4ki0 (more details), 2.38 Å

PDB Description: crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose
PDB Compounds: (A:) ABC transporter related protein

SCOPe Domain Sequences for d4ki0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ki0a1 c.37.1.12 (A:2-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf
igekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevl
qlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhk
rlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig

SCOPe Domain Coordinates for d4ki0a1:

Click to download the PDB-style file with coordinates for d4ki0a1.
(The format of our PDB-style files is described here.)

Timeline for d4ki0a1: