| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.12: ABC transporter ATPase domain-like [52686] (25 proteins) there are two additional subdomains inserted into the central core that has a RecA-like topology |
| Protein Maltose transport protein MalK, N-terminal domain [52689] (2 species) |
| Species Escherichia coli [TaxId:562] [102380] (15 PDB entries) |
| Domain d4ki0a1: 4ki0 A:2-235 [228487] Other proteins in same PDB: d4ki0a2, d4ki0a3, d4ki0b2, d4ki0b3, d4ki0e_, d4ki0f1, d4ki0f2, d4ki0g_ automated match to d2awna2 complexed with anp, mg, pgv, umq |
PDB Entry: 4ki0 (more details), 2.38 Å
SCOPe Domain Sequences for d4ki0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ki0a1 c.37.1.12 (A:2-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]}
asvqlqnvtkawgevvvskdinldihegefvvfvgpsgcgkstllrmiagletitsgdlf
igekrmndtppaergvgmvfqsyalyphlsvaenmsfglklagakkevinqrvnqvaevl
qlahlldrkpkalsggqrqrvaigrtlvaepsvflldeplsnldaalrvqmrieisrlhk
rlgrtmiyvthdqveamtladkivvldagrvaqvgkplelyhypadrfvagfig
Timeline for d4ki0a1: