Lineage for d4ki0g_ (4ki0 G:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2634215Fold f.58: MetI-like [161097] (1 superfamily)
    core: 5 transmembrane helices; flattened bundle
  4. 2634216Superfamily f.58.1: MetI-like [161098] (1 family) (S)
  5. 2634217Family f.58.1.1: MetI-like [161099] (6 proteins)
    Pfam PF00528; Binding-protein-dependent transport system inner membrane component
  6. 2634236Protein Maltose transport system permease protein MalG [161104] (1 species)
  7. 2634237Species Escherichia coli [TaxId:562] [161105] (3 PDB entries)
    Uniprot P68183 7-296
  8. 2634238Domain d4ki0g_: 4ki0 G: [228483]
    Other proteins in same PDB: d4ki0a1, d4ki0a2, d4ki0a3, d4ki0b1, d4ki0b2, d4ki0b3, d4ki0e_, d4ki0f1, d4ki0f2
    automated match to d2r6gg1
    complexed with anp, mg, pgv, umq

Details for d4ki0g_

PDB Entry: 4ki0 (more details), 2.38 Å

PDB Description: crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose
PDB Compounds: (G:) Binding-protein-dependent transport systems inner membrane component

SCOPe Domain Sequences for d4ki0g_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ki0g_ f.58.1.1 (G:) Maltose transport system permease protein MalG {Escherichia coli [TaxId: 562]}
sqkarlfithlllllfiaaimfpllmvvaislrqgnfatgslipeqiswdhwklalgfsv
eqadgritpppfpvllwlwnsvkvagisaigivalsttcayafarmrfpgkatllkgmli
fqmfpavlslvalyalfdrlgeyipfiglnthggvifaylggialhvwtikgyfetidss
leeaaaldgatpwqafrlvllplsvpilavvfilsfiaaitevpvaslllrdvnsytlav
gmqqylnpqnylwgdfaaaavmsalpitivfllaqrwlvngltaggvkg

SCOPe Domain Coordinates for d4ki0g_:

Click to download the PDB-style file with coordinates for d4ki0g_.
(The format of our PDB-style files is described here.)

Timeline for d4ki0g_: