Lineage for d4i5xa_ (4i5x A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1568069Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 1568070Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 1568129Protein Aldose reductase (aldehyde reductase) [51436] (2 species)
  7. 1568130Species Human (Homo sapiens) [TaxId:9606] [51437] (102 PDB entries)
    Uniprot P15121
  8. 1568229Domain d4i5xa_: 4i5x A: [228451]
    automated match to d4gqga_
    complexed with flf, nap

Details for d4i5xa_

PDB Entry: 4i5x (more details), 2.1 Å

PDB Description: Crystal Structure Of AKR1B10 Complexed With NADP+ And Flufenamic acid
PDB Compounds: (A:) Aldo-keto reductase family 1 member B10

SCOPe Domain Sequences for d4i5xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i5xa_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]}
ahmatfvelstkakmpivglgtwksplgkvkeavkvaidagyrhidcayvyqnehevgea
iqekiqekavkredlfivsklwptfferplvrkafektlkdlklsyldvylihwpqgfks
gddlfpkddkgnaiggkatfldaweameelvdeglvkalgvsnfshfqiekllnkpglky
kpvtnqvechpyltqekliqychskgitvtaysplgspdrpwakpedpslledpkikeia
akhkktaaqvlirfhiqrnvivipksvtpariveniqvfdfklsdeematilsfnrnwra
cnvlqsshledypfdaey

SCOPe Domain Coordinates for d4i5xa_:

Click to download the PDB-style file with coordinates for d4i5xa_.
(The format of our PDB-style files is described here.)

Timeline for d4i5xa_: