Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (67 species) not a true protein |
Species Labrenzia aggregata [TaxId:384765] [228392] (1 PDB entry) |
Domain d4mggf1: 4mgg F:0-127 [228393] Other proteins in same PDB: d4mgga2, d4mggb2, d4mggc2, d4mggd2, d4mgge2, d4mggf2, d4mggg2, d4mggh2 automated match to d3fv9b1 complexed with cl, mg, ni |
PDB Entry: 4mgg (more details), 2.2 Å
SCOPe Domain Sequences for d4mggf1:
Sequence, based on SEQRES records: (download)
>d4mggf1 d.54.1.0 (F:0-127) automated matches {Labrenzia aggregata [TaxId: 384765]} hmkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplgsaylp syalgvrsglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatgq plytllgg
>d4mggf1 d.54.1.0 (F:0-127) automated matches {Labrenzia aggregata [TaxId: 384765]} hmkitainvfqvdlplregryswsngnfvevfdstvveietdeglkgyaeccplsyalgv rsglqelaphligkdplnigeinrvmdaalrghpyakapidiacwdllgkatgqplytll gg
Timeline for d4mggf1: