Lineage for d4mggd2 (4mgg D:128-367)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1565956Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1573508Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 1573839Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 1573840Protein automated matches [226923] (59 species)
    not a true protein
  7. 1574026Species Labrenzia aggregata [TaxId:384765] [228394] (1 PDB entry)
  8. 1574030Domain d4mggd2: 4mgg D:128-367 [235623]
    Other proteins in same PDB: d4mgga1, d4mggb1, d4mggc1, d4mggd1, d4mgge1, d4mggf1, d4mggg1, d4mggh1
    automated match to d4mggf2
    complexed with cl, mg, ni

Details for d4mggd2

PDB Entry: 4mgg (more details), 2.2 Å

PDB Description: Crystal structure of an enolase (mandelate racemase subgroup) from labrenzia aggregata iam 12614 (target nysgrc-012903) with bound mg, space group p212121
PDB Compounds: (D:) muconate lactonizing enzyme

SCOPe Domain Sequences for d4mggd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4mggd2 c.1.11.0 (D:128-367) automated matches {Labrenzia aggregata [TaxId: 384765]}
aaqddvalyraisqeapeimakkiegyaaegytkfqlkvggdanddinrihatrsvlkks
dllvadantgwtrheaarvvgavssldvyieqpcltyeesvsirrrtalpfvldevidgp
ntlvrgiaedamdcinlkiskvggltkaklmrdlciahgipmtiedtwggdivtaaiahl
arstpseftfsatdfnsygtvdiaegapkrvngrmttsdlpglgitpifdvlgepvarys

SCOPe Domain Coordinates for d4mggd2:

Click to download the PDB-style file with coordinates for d4mggd2.
(The format of our PDB-style files is described here.)

Timeline for d4mggd2: