SCOPe 2.07: Domain d4i5qb2: 4i5q B:61-214

Lineage for d4i5qb2 (4i5q B:61-214)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (3 proteins)
   elaborated common fold

6. Protein automated matches [228323] (3 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:99287] [228324] (2 PDB entries)

8. Domain d4i5qb2: 4i5q B:61-214 [228327]
   Other proteins in same PDB: d4i5qa1, d4i5qa3, d4i5qb1, d4i5qb3
   automated match to d1eeja1
   complexed with mg

Details for d4i5qb2

PDB Entry: 4i5q, 1.96 Å

PDB Description: crystal structure and catalytic mechanism for peroplasmic disulfide- bond isomerase dsbc from salmonella enterica serovar typhimurium

PDB Compounds: (B:) thiol:disulfide interchange protein dsbc

SCOPe Domain Sequences for d4i5qb2:

Sequence; same for both SEQRES and ATOM records:

>d4i5qb2 c.47.1.9 (B:61-214) automated matches {Salmonella typhimurium [TaxId: 99287]}
nvtnkllmsqlnalekemivykapdekhvitvftditcgychklheemkdynalgitvry
lafprqglesqaeqdmksiwcakdknkafddamagkgvkpascdvniadhyalgvqlgvs
gtpaivlsngyvvpgyqgpkemkafldehqkqts

Timeline for d4i5qb2:

• d4i5qb2 first appeared in SCOPe 2.03
  
• d4i5qb2 appears in SCOPe 2.06
  
• d4i5qb2 appears in the current release, SCOPe 2.08