Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (3 proteins) elaborated common fold |
Protein automated matches [228323] (2 species) not a true protein |
Species Salmonella typhimurium [TaxId:99287] [228324] (2 PDB entries) |
Domain d4i5qb2: 4i5q B:61-214 [228327] Other proteins in same PDB: d4i5qa1, d4i5qb1 automated match to d1eeja1 complexed with mg |
PDB Entry: 4i5q (more details), 1.96 Å
SCOPe Domain Sequences for d4i5qb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i5qb2 c.47.1.9 (B:61-214) automated matches {Salmonella typhimurium [TaxId: 99287]} nvtnkllmsqlnalekemivykapdekhvitvftditcgychklheemkdynalgitvry lafprqglesqaeqdmksiwcakdknkafddamagkgvkpascdvniadhyalgvqlgvs gtpaivlsngyvvpgyqgpkemkafldehqkqts
Timeline for d4i5qb2: