Lineage for d4i5qb2 (4i5q B:61-214)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1369337Family c.47.1.9: DsbC/DsbG C-terminal domain-like [52898] (3 proteins)
    elaborated common fold
  6. 1369363Protein automated matches [228323] (2 species)
    not a true protein
  7. 1369364Species Salmonella typhimurium [TaxId:99287] [228324] (2 PDB entries)
  8. 1369368Domain d4i5qb2: 4i5q B:61-214 [228327]
    Other proteins in same PDB: d4i5qa1, d4i5qb1
    automated match to d1eeja1
    complexed with mg

Details for d4i5qb2

PDB Entry: 4i5q (more details), 1.96 Å

PDB Description: crystal structure and catalytic mechanism for peroplasmic disulfide- bond isomerase dsbc from salmonella enterica serovar typhimurium
PDB Compounds: (B:) thiol:disulfide interchange protein dsbc

SCOPe Domain Sequences for d4i5qb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4i5qb2 c.47.1.9 (B:61-214) automated matches {Salmonella typhimurium [TaxId: 99287]}
nvtnkllmsqlnalekemivykapdekhvitvftditcgychklheemkdynalgitvry
lafprqglesqaeqdmksiwcakdknkafddamagkgvkpascdvniadhyalgvqlgvs
gtpaivlsngyvvpgyqgpkemkafldehqkqts

SCOPe Domain Coordinates for d4i5qb2:

Click to download the PDB-style file with coordinates for d4i5qb2.
(The format of our PDB-style files is described here.)

Timeline for d4i5qb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i5qb1