SCOP 1.73: Domain d1c3ga1: 1c3g A:180-259

Lineage for d1c3ga1 (1c3g A:180-259)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.4: HSP40/DnaJ peptide-binding domain [49492] (1 superfamily)
   sandwich; 6 strands in 2 sheets

4. Superfamily b.4.1: HSP40/DnaJ peptide-binding domain [49493] (1 family)

5. Family b.4.1.1: HSP40/DnaJ peptide-binding domain [49494] (2 proteins)

6. Protein Heat shock protein 40 Sis1 [49495] (1 species)
   duplication: contains two domains of this fold

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49496] (2 PDB entries)

8. Domain d1c3ga1: 1c3g A:180-259 [22831]

Details for d1c3ga1

PDB Entry: 1c3g, 2.7 Å

PDB Description: s. cerevisiae heat shock protein 40 sis1

PDB Compounds: (A:) heat shock protein 40

SCOP Domain Sequences for d1c3ga1:

Sequence; same for both SEQRES and ATOM records:

>d1c3ga1 b.4.1.1 (A:180-259) Heat shock protein 40 Sis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
etvqvnlpvsledlfvgkkksfkigrkgphgasektqidiqlkpgwkagtkityknqgdy
npqtgrrktlqfviqekshp

Timeline for d1c3ga1:

• d1c3ga1 first appeared (with stable ids) in SCOP 1.55
  
• d1c3ga1 appears in SCOP 1.71
  
• d1c3ga1 appears in SCOP 1.75
  
• d1c3ga1 appears in the current release, SCOPe 2.08