Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily) beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4) |
Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) |
Family d.120.1.1: Cytochrome b5 [55857] (5 proteins) |
Protein automated matches [190702] (5 species) not a true protein |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [187846] (5 PDB entries) |
Domain d4hilb_: 4hil B: [228303] automated match to d3musa_ complexed with hem, na |
PDB Entry: 4hil (more details), 1.25 Å
SCOPe Domain Sequences for d4hilb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hilb_ d.120.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]} vtyyrleevakrntaeetwmvihgrvyditrflsehpggeevlleqagadatesfedvgh spdaremlkqyyigdvhpndl
Timeline for d4hilb_: