SCOPe 2.07: Domain d4hilb_: 4hil B:

Lineage for d4hilb_ (4hil B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
   beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)

4. Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families)

5. Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)

6. Protein automated matches [190702] (5 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [187846] (5 PDB entries)

8. Domain d4hilb_: 4hil B: [228303]
   automated match to d3musa_
   complexed with hem, na

Details for d4hilb_

PDB Entry: 4hil, 1.25 Å

PDB Description: 1.25a resolution structure of rat type b cytochrome b5

PDB Compounds: (B:) Cytochrome b5 type B

SCOPe Domain Sequences for d4hilb_:

Sequence; same for both SEQRES and ATOM records:

>d4hilb_ d.120.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vtyyrleevakrntaeetwmvihgrvyditrflsehpggeevlleqagadatesfedvgh
spdaremlkqyyigdvhpndl

Timeline for d4hilb_:

• d4hilb_ first appeared in SCOPe 2.03
  
• d4hilb_ appears in SCOPe 2.06
  
• d4hilb_ appears in the current release, SCOPe 2.08