Lineage for d4hilb_ (4hil B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973074Fold d.120: Cytochrome b5-like heme/steroid binding domain [55855] (1 superfamily)
    beta-alpha-beta(2)-alpha(1,2)-(beta)-alpha(2)-beta; 3 layers: a/b/a; antiparallel beta-sheet, order: 1532(4)
  4. 2973075Superfamily d.120.1: Cytochrome b5-like heme/steroid binding domain [55856] (3 families) (S)
  5. 2973076Family d.120.1.1: Cytochrome b5 [55857] (5 proteins)
  6. 2973147Protein automated matches [190702] (5 species)
    not a true protein
  7. 2973165Species Norway rat (Rattus norvegicus) [TaxId:10116] [187846] (5 PDB entries)
  8. 2973167Domain d4hilb_: 4hil B: [228303]
    automated match to d3musa_
    complexed with hem, na

Details for d4hilb_

PDB Entry: 4hil (more details), 1.25 Å

PDB Description: 1.25a resolution structure of rat type b cytochrome b5
PDB Compounds: (B:) Cytochrome b5 type B

SCOPe Domain Sequences for d4hilb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hilb_ d.120.1.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
vtyyrleevakrntaeetwmvihgrvyditrflsehpggeevlleqagadatesfedvgh
spdaremlkqyyigdvhpndl

SCOPe Domain Coordinates for d4hilb_:

Click to download the PDB-style file with coordinates for d4hilb_.
(The format of our PDB-style files is described here.)

Timeline for d4hilb_: