SCOPe 2.08: Domain d4mllb_: 4mll B:

Lineage for d4mllb_ (4mll B:)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Class D beta-lactamase [56622] (4 species)

7. Species Escherichia coli, OXA-1 [TaxId:562] [82837] (4 PDB entries)

8. Domain d4mllb_: 4mll B: [228264]
   automated match to d4f7yb_
   complexed with 1s6, mpd, po4

Details for d4mllb_

PDB Entry: 4mll, 1.37 Å

PDB Description: The 1.4 A structure of the class D beta-lactamase OXA-1 K70D complexed with oxacillin

PDB Compounds: (B:) beta-lactamase OXA-1

SCOPe Domain Sequences for d4mllb_:

Sequence; same for both SEQRES and ATOM records:

>d4mllb_ e.3.1.1 (B:) Class D beta-lactamase {Escherichia coli, OXA-1 [TaxId: 562]}
stdistvasplfegtegcfllydastnaeiaqfnkakcatqmapdstfdialslmafdae
iidqktifkwdktpkgmeiwnsnhtpktwmqfsvvwvsqeitqkiglnkiknylkdfdyg
nqdfsgdkernnglteawlesslkispeeqiqflrkiinhnlpvknsaientienmylqd
ldnstklygktgagftanrtlqngwfegfiisksghkyvfvsaltgnlgsnltssikakk
naitilntlnl

Timeline for d4mllb_:

• d4mllb_ first appeared in SCOPe 2.03
  
• d4mllb_ appears in SCOPe 2.07