Lineage for d4lacc_ (4lac C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1679877Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
    4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication
  4. 1679878Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) (S)
    different families of this superfamily are groupped in a single Pfam family, Pfam PF00149
  5. 1679954Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)
  6. 1679960Protein Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha [143933] (1 species)
  7. 1679961Species Human (Homo sapiens) [TaxId:9606] [143934] (12 PDB entries)
    Uniprot P67775 2-294
  8. 1679973Domain d4lacc_: 4lac C: [228232]
    Other proteins in same PDB: d4lacb_
    automated match to d4i5lf_
    complexed with ags, mes, mn, peg

Details for d4lacc_

PDB Entry: 4lac (more details), 2.82 Å

PDB Description: Crystal Structure of Protein Phosphatase 2A (PP2A) and PP2A phosphatase activator (PTPA) complex with ATPgammaS
PDB Compounds: (C:) Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform

SCOPe Domain Sequences for d4lacc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lacc_ d.159.1.3 (C:) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]}
kvftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvhgqfh
dlmelfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhesrqi
tqvygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldhiral
drlqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsrahql
vmegynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpap

SCOPe Domain Coordinates for d4lacc_:

Click to download the PDB-style file with coordinates for d4lacc_.
(The format of our PDB-style files is described here.)

Timeline for d4lacc_: