SCOPe 2.08: Domain d4lacc_: 4lac C:

Lineage for d4lacc_ (4lac C:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily)
   4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication

4. Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families)
   different families of this superfamily are groupped in a single Pfam family, Pfam PF00149

5. Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins)

6. Protein Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha [143933] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143934] (12 PDB entries)
   Uniprot P67775 2-294

8. Domain d4lacc_: 4lac C: [228232]
   Other proteins in same PDB: d4lacb_
   automated match to d4i5lf_
   complexed with ags, mes, mn, peg

Details for d4lacc_

PDB Entry: 4lac, 2.82 Å

PDB Description: Crystal Structure of Protein Phosphatase 2A (PP2A) and PP2A phosphatase activator (PTPA) complex with ATPgammaS

PDB Compounds: (C:) Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform

SCOPe Domain Sequences for d4lacc_:

Sequence; same for both SEQRES and ATOM records:

>d4lacc_ d.159.1.3 (C:) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]}
kvftkeldqwieqlneckqlsesqvkslcekakeiltkesnvqevrcpvtvcgdvhgqfh
dlmelfriggkspdtnylfmgdyvdrgyysvetvtllvalkvryreritilrgnhesrqi
tqvygfydeclrkygnanvwkyftdlfdylpltalvdgqifclhgglspsidtldhiral
drlqevphegpmcdllwsdpddrggwgisprgagytfgqdisetfnhangltlvsrahql
vmegynwchdrnvvtifsapnycyrcgnqaaimelddtlkysflqfdpap

Timeline for d4lacc_:

• d4lacc_ first appeared in SCOPe 2.03
  
• d4lacc_ appears in SCOPe 2.07